Panasonic SG-P Series Quick Instruction Manual

Panasonic SG-P Series Quick Instruction Manual Manual pdf 1 page image

QUICK INSTRUCTION MANUALNon-Contact Safety Door SwitchSG-P SeriesMJE-SGP No.0095-77VThank you very much for purchasing Panasonic products.Please read this Instruction Manual carefully and thoroughly for the correctand optimum use of this product. Kindly keep this manual in a convenientplace for quick reference.This document provides a brief summary of mounting, wiring, and other related information.When using the product, refer to the SG-P Series Instruction Manual in addition to this manual.1 SAFETY CAUTIONS Always observeThis section explains important rules that must be observed to prevent human injury and property damage.Ŷ 7KHKD]DUGVWKDWPD\RFFXULIWKHSURGXFWLVXVHGLQFRUUHFWO\DUHGHVFULEHGDQGFODVVL¿HGE\OHYHORIKDUPWARNING Risk of death or serious injury.CAUTION Risk of minor injury or property damage.WARNINGMachine designer, installer, employer and operator• The machine designer, installer, employer and operator are solely responsible toensure that all applicable legal requirements relating to the installation and the useLQDQ\DSSOLFDWLRQDUHVDWLV¿HGDQGDOOLQVWUXFWLRQVIRULQVWDOODWLRQDQGPDLQWHQDQFHcontained in the instruction manual are followed.• Whether this device functions as intended to and systems including this devicecomply with safety regulations depends on the appropriateness of the application,installation, maintenance and operation. The machine designer, installer, employerand operator are solely responsible for these items.Engineer• The engineer would be a person who is appropriately educated, has widespreadknowledge and experience, and can solve various problems which may ariseduring work, such as a machine designer, installer or employer etc.Operator• The operator should read this instruction manual thoroughly, understand its con-tents, and perform operations following the procedures described in this manualfor the correct operation of this device.• In case this device does not perform properly, the operator should report this to theperson in charge and stop the machine operation immediately. The machine mustQRWEHRSHUDWHGXQWLOFRUUHFWSHUIRUPDQFHRIWKLVGHYLFHKDVEHHQFRQ¿UPHGOperating environment• Do not use this device outdoors.• Do not use this device in an explosion-proof area.• Do not install this device in the following places:1) Areas with high humidity where condensation is likely to occur2) Areas exposed to corrosive or explosive gases3) Areas exposed to contact with water4) Areas exposed to too much steam or dust• Do not use this device near equipment that emits strong electromagnetic waves.Machine in which this device is installed• Do not install this device with a machine whose operation cannot be stoppedimmediately in the middle of an operation cycle by an emergency stop equipment.• This device starts the performance after approximately 2 seconds from the powerON.Have the control system started to function with this timing.• Do not use the device improperly or do not invalidate the settings after installingthe device. Otherwise, the safety functions of the apparatus which uses this devicemay not work properly, resulting in death or serious injury.• Do not install the switch body of this device on a movable door.• When installing this device, always consider the time required to ensure a safe stateand provide a distance equal to or longer than the correctly calculated safety distancebetween the apparatus which uses this device and the dangerous parts of the machine.• &RQ¿UPWKDWWKHUHVSRQVHWLPHRIWKHHQWLUHPDFKLQHLVOHVVWKDQWKHFDOFXODWHGvalue before designing the equipment.Wiring• Be sure to carry out the wiring in the power supply OFF condition.• All electrical wiring should conform to the regional electrical regulations and laws.The wiring should be done by engineer(s) having the special electrical knowledge.• After completing wiring, check the wiring state before supplying power.• Do not wire the controller in parallel with a high-voltage line or power line or use thesame conduit as these lines. Doing so may result in malfunctioning due to induction.• Do not apply stress such as excessive bending or pulling to a cable or theextracted part of a cable. In particular, when the temperature is low, cable materialsharden, and when the temperature is high, the materials soften, and so take carethat cables may break if they are subject to stress such as bending or pulling whenthe temperature is low or high.• When connecting multiple switch bodies, arrange their layout so that the total cablelength is 100 m or less. Furthermore, determine the distance between the switchbodies so that the maximum cable length between them is 20 m or less.• When using only one switch body, arrange its layout so that the maximum cable length is 20 m or less.• When extending the cable of this device, use 0.3 mm 2 or larger cable.• When wiring, make sure that liquid such as water or oil does not intrude from the end of the cable.Maintenance• When replacement parts are required, always use only genuine suppliedreplacement parts. Using substitute parts from another manufacturer may causethe device not to detect objects, resulting in death or serious injury.• The periodical inspection of this device must be performed by an engineer having the special knowledge.• After maintenance or adjustment, and before starting operation, test this deviceIROORZLQJWKHSURFHGXUHVSHFL¿HGLQ³ 8 Maintenance”.• Clean this device with a clean cloth. Do not use any volatile chemicals.Others• 1HYHUPRGLI\WKLVGHYLFH0RGL¿FDWLRQPD\FDXVHWKHGHYLFHQRWWRGHWHFWREMHFWVresulting in death or serious injury.CAUTION6SHFL¿FDWLRQV• This product has been developed / produced for industrial use only.• 'RQRWXVHWKLVSURGXFWRXWVLGHWKHUDQJHRIWKHVSHFL¿FDWLRQV5LVNRIDQDFFLGHQWDQGSURGXFWGDPDJH• There is also a risk of a noticeable reduction of service life.• Use this device by installing suitable protection equipment as a countermeasurefor failure, damage, or malfunction of this device.• Before using this device, check whether the device performs properly with theIXQFWLRQVDQGFDSDELOLWLHVDVSHUWKHGHVLJQVSHFL¿FDWLRQV• Note that this device may be damaged if it is subject to a strong shock (if it isGURSSHGRQWRWKHÀRRUIRUH[DPSOH • Do not use the device near an apparatus that generates magnetic fields.2WKHUZLVHWKHRSHUDWLQJGLVWDQFHPD\EHDႇHFWHG• Do not apply an excessive shock to the safety switch when opening or closing the door.• Use of this device under the following conditions or environments is not presupposed.Please consult us if there is no other choice but to use this device in such an environment.1) Operating this device under conditions or environments not described in this manual.2) 8VLQJWKLVGHYLFHLQWKHIROORZLQJ¿HOGVQXFOHDUSRZHUFRQWUROUDLOURDGDLUFUDIWauto mobiles, combustion facilities, medical systems, aerospace development, etc.Power supply• 9HULI\WKDWWKHVXSSO\YROWDJHÀXFWXDWLRQVDUHZLWKLQWKHUDWLQJ• When using a commercial switching regulator for the power supply, be sure toground the frame ground (F.G.) terminal of the power supply.• When using the device, avoid the transient state that occurs when the power supply is turned ON.• When connecting multiple devices together, connect all the devices to the same power supply.Other precautions• Never attempt to disassemble, repair, or modify the product.• When the product becomes unusable or unneeded, dispose of the productproperly as industrial waste by abiding by the applicable law in the country.2 CONTENTS OF PACKAGEDevice : Switch body, Actuator 1 unit4XLFN,QVWUXFWLRQ0DQXDO -DSDQHVH(QJOLVK6LPSOL¿HG&KLQHVH 1 PC eachGeneral Information for Safety, Compliance, and Instructions 1 PC3 PRODUCT CONFIGURATIONƔ 7KLVGHYLFHLVFRQ¿JXUHGRQDVZLWFKERG\DQGDQDFWXDWRUƔ This device is available as the 6*3ƑƑ0 standard units and as the 6*3ƑƑ6sub units. For one 6*3ƑƑ0 standard unit, up to a maximum of 29 6*3ƑƑ6sub units can be operated by connecting them in a cascade connection.Ɣ )RUGHWDLOVRQ0RGHO1RUHIHUWR³ 9 Model No.”.Possible to connect a maximum of 29 units.SafetycontrollerPower supply unitStandard6*3ƑƑ-MSub 6*3ƑƑ-SActuatorSwitch bodySub 6*3ƑƑ-SSub 6*3ƑƑ-SƔ Note that the 6*3ƑƑ6 sub unit cannot be used alone. When using a singledevice, use the 6*3ƑƑ0 standard unit. When connecting multiple devicestogether, use the 6*3ƑƑ6 sub unit for the second unit onwards.Ɣ The 6*3ƑƑ0 standard unit can be connected with all 6*3ƑƑ6 sub units.Ɣ Be sure to use this device together with a safety device such as a safety controller.4 NAME AND FUNCTION OF THE DEVICEƔ Compact typeName FunctionIndicatorLights green When the actuator is detectedLights red When the actuator is not detectedBlinks red •Lockout state, error occurrence• When the teaching sequence was incorrect (only when using high code models)Blinks green • When multiple units are connected, the actuator is not detected by other switch bodies.• When multiple units are connected, an error has occurred in other switch bodies.Lights yellow (Green, red,simultaneous lighting) After the power ON, self-diagnosisAlternately blinking red and yellow(lights red and blinks green) When an actuator not paired is detected (only when using high code models)Actuator detection surface When the actuator is brought near to the surface, the switch body detects the actuator.Switch body detection surface When the actuator is brought near to the switch body, the switch body detects the actuator.Switch body detection surfaceIndicator Actuator detection surfaceIndicatorƔ Visible typeName FunctionIndicatorLights green When the actuator is detectedLights red When the actuator is not detectedBlinks red •Lockout state, error occurrence• When the teaching sequence was incorrect (only when using high code models)Blinks green • When multiple units are connected, the actuator is not detected by other switch bodies.• When multiple units are connected, an error has occurred in other switch bodies.Lights yellow (Green, red,simultaneous lighting)(Note) After the power ON, self-diagnosisAlternately blinking red and yellow(lights red and blinks green)(Note) When an actuator not paired is detected (only when using high code models)Actuator detection surface When the actuator is brought near to the surface, the switch body detects the actuator.Switch body detection surface When the actuator is brought near to the switch body, the switch body detects the actuator.IndicatorIndicatorTransmission partSwitch bodydetection surfaceActuator detection surfaceNote: When check the LED light transmitted to the actuator, depending on the angle, yellow lights may separated into green and red.5 MOUNTINGMount the switch body on a machine unitor on a guard and mount the actuator ona movable door. Use M4 screw, washerand spring washer (to be preparedby the customer) to mount the deviceDQG¿UPO\WLJKWHQWKHPWRWKHVSHFL¿HGtightening torque. Visible type actuator isuniquely designed to light the indicatorof the switch body by transmitting lightthrough it. Even if the indicator of theswitch body is hidden when the actuatoris detected, the visibility is not degraded.M4 screw (length: 20mm or more)WasherSpring washer6SHFL¿HGWLJKWHQLQJWRUTXH1āPMovable doorIndicatorSwitch bodyGuardActuatorThe light of the indicator is transmittedto the actuator to light the actuator.(only when using visible type)Ɣ Do not install the switch body of this device on a movable door.Ɣ Mount the switch body carefully so that it does not come in contact with themovable door.Ɣ Mount the switch body in a location where it cannot be reached or it is hidden sothat it cannot be easily disabled. Or, mount the switch body in such a way that itcannot be removed with ordinary tools.Ɣ For detailed information about minimizing the probability that it might be disabled,refer to relevant precautions described in ISO14119.6 Sensing AreaƔ Compact typeX YZ7.5mmY directionZ direction0-4481216-8-12-160 2 4 6 8ON areaUnits: mmY directionX direction0-4481216-8-12-160 2 4 6 8Units: mmON areaƔ Visible typeYZ7.5mmY directionX direction0-4481216-8-12-160 2 4 6 8Units: mmON area 0-4481216-8-12-160 2 4 6 8Y directionX directionON areaUnits: mm7KHDERYH¿JXUHUHSUHVHQWVW\SLFDOGDWD&KHFNWKHDFWXDOLQVWDOODWLRQHQYLURQPHQWto make sure that there is no problem.7 CONNECTING THE SWITCH BODY WITH THE CONTROLLER AND POWER SUPPLY UNITCAUTIONƔ If the power supply used for this device is shared by other devices, the devicePD\EHDႇHFWHGE\QRLVHHPLWWHGIURPRWKHUGHYLFHV'RQRWVKDUHWKHSRZHUsupply used for this device with other devices.Ɣ The power supply unit used for this device must satisfy the following requirements. 7KHSRZHUVXSSO\XQLWPXVWEHFHUWL¿HGIRUXVHLQ\RXUUHJLRQ2) The power supply unit must have the rated output voltage of 24 VDC +10-20 % andthe ripple (P-P) of 10% or less.3) The power supply with SELV (Secondary Extra Low Voltage) or PELV(Protective Extra Low Voltage) that comply with the RE Directive must beused. (When CE Marking is required)4) The power supply with SELV (Secondary Extra Low Voltage) or PELV(Protective Extra Low Voltage) that comply with the RE Regulations must beused. (When UKCA Marking is required) 7KHSRZHUVXSSO\PXVWFRPSO\ZLWK&ODVVGH¿QHGE\8/RUVDWLVI\WKHoutput characteristics requirements of the limited voltage and current circuit.6) The power supply unit must have reinforced insulation or double insulationbetween the primary circuit and secondary circuit.7) When using a commercial switching regulator, the frame ground (F.G.)terminal must be connected to ground.8) The power supply unit must have an output holding time of 20 ms or more.9) If surges occur, take countermeasures such as connecting a surge absorber to the source of the surges.Ɣ Using Only One Switch Body(Note)6*3ƑƑ-M-P(Brown) +V(Blue)0V(Black)OSSD1(White)OSSD2(Pink) Check input(Gray) Check output< For PNP output type >SafetyController Powersupply unit+V0V6*3ƑƑ-M-N< For NPN output type >SafetyController+V0VPowersupply unit(Note)(Brown) +V(Blue)0V(Black)OSSD1(White)OSSD2(Pink) Check input(Gray) Check outputNote: Connect the check input line (pink) with the check output line (gray).Ɣ Using Multiple Units in Series Connection(Note)SG-PƑƑ-S 1st unitSG-PƑƑ-S 29th unit< For NPN output type >6*3ƑƑ-M-N+V0V(Brown) +V(Black)OSSD1(White)OSSD2(Blue)0V(Gray) Check output(Pink) Check input(Pink) Check input(Pink) Check input(Brown) +V(Blue)0V(Gray) Check output(Brown) +V(Blue)0V(Gray) Check outputSafetyController Powersupply unit< For PNP output type >6*3ƑƑ-M-PSG-PƑƑ-S 1st unitSG-PƑƑ-S 29th unit+V0V(Brown) +V(Brown) +V(Black)OSSD1(White)OSSD2(Blue)0V(Blue)0V(Pink) Check input(Pink) Check input(Pink) Check input(Gray) Check output(Gray) Check output(Brown) +V(Blue)0V(Gray) Check outputSafetyController Powersupply unit(Note)Note: For connecting multiple units, connect the check output line (gray) with the check input line (pink) of the6*3ƑƑ6 sub unit connected next. Connect the check output line (gray) of the 6*3ƑƑ6 sub unit connected atthe end with the check input line (pink) of the 6*3ƑƑ0 standard unit placed at the beginning.8 MAINTENANCE,I\RXGLVFRYHUDQDEQRUPDOFRQGLWLRQUHIHUWR³SG-P Series Instruction Manual”DQGLQIRUP\RXUWHFKQLFLDQ,I\RXDUHXQVXUHZKDWDFWLRQWRWDNHFRQWDFWRXURႈFHMake a copy of the checklist, put a checkmark after checking each item, and retain the checklist.Ɣ Daily InspectionWARNINGBefore starting work, inspect the following items and verify that there are no abnormalities.Operating this device without performing the inspection or without removing the abnormalcondition may cause death or serious injury.Check column Inspection itemƑ 7KHVZLWFKERG\DQGWKHDFWXDWRUDUHPRXQWHGDFFRUGLQJWRWKHPRXQWLQJDQGZLULQJVSHFL¿FDWLRQVDQGWKHdoor and other structures where they are mounted are installed according to the installation conditions.Ƒ The door is not deformed or warped.Ƒ Check every door if the machine stops when the door opens.Ƒ 7KHUH LV QR FKDQJH LQ WKH LQVWDOODWLRQ HQYLURQPHQW WKDW PD\ DႇHFW WKH UHVXOWV RI WKH ULVN DVVHVVPHQWperformed before this device was installed.Ƒ If seal was applied to the mounting screws, the seal must remain unchanged.Ƒ There is no scratch, dirt, or damage in this device.Ƒ There is no scratch, bent, or damage in the wiring.Ɣ Periodic InspectionWARNING$FFRUGLQJWRWKHSHULRGLFLQVSHFWLRQIUHTXHQF\DVVSHFL¿HGLQ,62LQVSHFWthe following items and verify that there are no abnormalities. Operating this devicewithout performing the inspection or without removing the abnormal condition maycause death or serious injury.Inspection frequencySIL3/PLe: At least once a month, SIL2/PLd: At least once a yearCheck column Inspection itemƑ The structure of the machine does not prevent any safety mechanisms from causing the machine tostop or to make an emergency stop.Ƒ 1RPRGL¿FDWLRQKDVEHHQPDGHLQWKHPDFKLQHFRQWUROV\VWHPWKDWREVWUXFWVWKHVDIHW\PHFKDQLVPVƑ There is no change in the installation environment of the switch body, the actuator and the door where they are mounted.Ƒ The response time of the overall system is equal to or less than the calculated value.Ƒ No screws or connectors related to the device are loose.Ɣ Inspection after Maintenance1. When changes are made to the installation, wiring, or functions of the device.2. When the switch body or actuator is replaced.3. When changes are made to the settings of the safety devices such as the safety controller.4. When an abnormal condition is noticed during operation of this device.9 Model No.SG-P 1 2 - 3 - 410: Compact type, 20: Visible type210: Low code, 20: High code1P: PNP output, N: NPN output (Note)4M: Standard, S: Sub3Note: Provided only on the 6*3ƑƑ0 standard unit.10 SPECIFICATIONSModel Standard Sub6*3ƑƑ0 6*3ƑƑ6Operating distance Front / Side Sao㸦OFFЍON㸧:5 mm , Sar㸦ONЍOFF㸧:15 mmPower supply voltage 24 V DC+10 %/-20 % ripple P-P of 10 % or lessCurrent consumption 30 mA or less 20 mA or lessControl output OSSD1 / 2 Note 1Maximum source PNP /sink NPN current:100 mA,Residual voltage:2 V or less,Leakage current:0.2 mA or less,Maximum load capacity: 0.47 ȣF,Load wiring resistance: 3 Ȑ or less-Response time For single unit:100 ms or less,For multiple units: Time for single unit 㸩 5 ms number of connectedunits - 1Number of units connected in series 30 units or less Standard 1 unit, Sub 29 unitsAmbient temperature -10 to +55 Υ No condensation or icing , storage: -25 to +65 ΥAmbient humidity 30 to 85 % RH, storage: 30 to 95 % RHNote 1):Provided only on the 6*3ƑƑ0 standard unit.Panasonic Industry Co., Ltd.1006, Oaza Kadoma, Kadoma-shi, Osaka 571-8506, Japanhttps://industry.panasonic.com/Please visit our website for inquiries and about our sales network.Panasonic Industry Co., Ltd. 2024April, 2024 PRINTED IN JAPAN

/ 2

Related manuals for Panasonic SG-P M Series